PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G0404
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family Trihelix
Protein Properties Length: 846aa    MW: 94766.3 Da    PI: 7.7476
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G0404genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix28.54e-092162791781
     trihelix  17 meerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpy 81 
                  +  +++rgk ++ + +ev++++ ++g++r +k+   kw+n+ ++++k+ e+e++++ e++   +y
  Gh_D07G0404 216 VAVQSKRGKTRADKDREVAEFLNKHGINRDAKTAGTKWDNMLGEFRKVYEWERGGEREQV-GKSY 279
                  556778999999*****************************************9965555.3445 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF561121.43E-15683837IPR011009Protein kinase-like domain
CDDcd001804.46E-11697834No hitNo description
Gene3DG3DSA:1.10.510.105.2E-7698835No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MGGNKGDATK KQTPQPTQQL SSSPKEPLEE SSESRQKHLQ QPSALVVTAT GPPFISAPLY  60
VPTGATSPYE QQFESVNPKR SRYNSGQWKL LPSPSSLQSQ AQMAIITSES SPSPTNPINP  120
QTQAQTTAAS SSDAASSPSH SPLPSTTSGQ ETNKPEDQQF HHQFRKGKYV SPVWKPNEML  180
WLARGWRIQY QGGSDAPGSS SRSGHQEIGP LTGSDVAVQS KRGKTRADKD REVAEFLNKH  240
GINRDAKTAG TKWDNMLGEF RKVYEWERGG EREQVGKSYF RLSPYERKLH RLPASFDEEV  300
FEELSKFMGP RMRTSQSRGA SAIASSDDGR SVLSGPRPLP PPPPFKVDEL PLSGFTERAQ  360
LPFAEPSIRS MPPLEFQDPT DYYIGCLRVP PTILPGLFEL SWHLQEPLPE EYRFPLRKDV  420
YRDLPAGKEV LFTTTSELLD CRAMVYDVLS SIIRTNPSLS AATATSRDSF IGLWDDCINR  480
VISKFCSVEM VIIRKPSSSS TEPLQDQWPN VTGFVRNFCL WRGEETDQVR EGHPDPSSSL  540
VEKLLWTYMD LPYVLGYYAV GYMVTFCALS RSQDRILRTD LYSVDLSSPS ERLKALVPCC  600
RIAGLLPLLA DRCFNTISNV GSYKQFPFSD FERINLRNGS IMEMTPNTVT RSFSNKKKWA  660
AVKEIYDILD HRIPHSELIC RACEKDLVLV FKPRGCKFKP INCEQLVEAV KYVTKALVAL  720
HDLCFMHRDL GWDKVLRRSD TENEWFVCGF DEAVGAPQIY PHPVAGADTD ARGRHAPEMG  780
RGLHGVKVDV WGVGYLIKTC GLTNVPKMLR ELETRCLDQN PEQRPTAADC YHHLLQVQSA  840
SSGAPY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465877.10.0PREDICTED: uncharacterized protein LOC105784438 isoform X2
TrEMBLA0A0D2QKQ50.0A0A0D2QKQ5_G
STRINGVIT_16s0022g02290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83561624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33550.16e-07Trihelix family protein